PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00031.1.g01720.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family GRAS
Protein Properties Length: 473aa    MW: 52166 Da    PI: 4.4818
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00031.1.g01720.1.am.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS202.91.9e-621004632372
                          GRAS   2 velLlecAeavssgdlelaqalLarlsel.....aspdgdpmqRlaayfteALaarlarsvselykalppsetseknssee 77 
                                    +lLl+ Aeav+ +d +la+a+L++l +l      +++  +++ la +f+++L++++++     y  + p+e +   +s +
  Zjn_sc00031.1.g01720.1.am.mk 100 SDLLLTGAEAVEIRDSSLASAVLSKLDHLlpdisENEANGSLHHLAYHFAQGLHHQMSG----AYTPCYPQELP---QSGV 173
                                   689*************************988853344448******************9....66666677777...6778 PP

                          GRAS  78 laalklfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg.skee 157
                                   ++a+ + +e sP++kf+h+t+NqaIl+a+  +  vH++Df+i +G+QW++++  L+   +g  s+ +T+v   +sg s ++
  Zjn_sc00031.1.g01720.1.am.mk 174 MSAHLMIQEFSPFVKFAHFTTNQAILDATMDDMDVHVVDFNIAEGVQWASFMSDLSR--HGDKSFHLTAVIIDDSGySDNT 252
                                   8888889************************************************98..5778999***999888899999 PP

                          GRAS 158 leetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkv 238
                                     +t  rL++fAe+l +pf++n+l ++   dl  ++++ + + ++++++     +l     sl++ +  ++ +vk+l+Pk+
  Zjn_sc00031.1.g01720.1.am.mk 253 CYTTVLRLSEFAESLSLPFKYNFLRVHYAGDL--DDFSRNCEGSVIISCDT--TNLCYT--SLSKLQILLIGCVKKLQPKL 327
                                   ***********************955555555..88888889999999987..444433..344444699*********** PP

                          GRAS 239 vvvveqe.......adhnsesFlerflealeyysalfdsleaklpres..eerikvErellgreivnvvacegaerrerhe 310
                                   vv++e++       a+++++sF+e f+e l+++++lf+sl++ +   +     + vEr ++g++i++ v + g+e      
  Zjn_sc00031.1.g01720.1.am.mk 328 VVIAEEDlvrmgkeASLSHASFVEFFFEGLHHFTVLFESLASCFNGGDdkVCLRLVERDVVGPKIQDFVGQHGSE------ 402
                                   *****995444444555666********************888766663466789*******************9...... PP

                          GRAS 311 tlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSa 372
                                   tl+    +    GF p +ls  + +qa+ll+  ++ + + v +e+g l l+Wk+rpLvsvS+
  Zjn_sc00031.1.g01720.1.am.mk 403 TLKAAAGANVLEGFMPCELSACNIAQARLLVGLFS-RSFGVANEKGRLQLCWKSRPLVSVSV 463
                                   444445555667***********************.66***********************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098530.35573446IPR005202Transcription factor GRAS
PfamPF035146.7E-60100463IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 473 aa     Download sequence    Send to blast
MMSYPCSPLL SFLPQEVGTD SLWSPHVALH DNATAADLSP IQLDDREFVD DTVGIDSSVF  60
HEQYCFDADA FANCDVRFLS EEGNNLAAIQ EELMEDSSLS DLLLTGAEAV EIRDSSLASA  120
VLSKLDHLLP DISENEANGS LHHLAYHFAQ GLHHQMSGAY TPCYPQELPQ SGVMSAHLMI  180
QEFSPFVKFA HFTTNQAILD ATMDDMDVHV VDFNIAEGVQ WASFMSDLSR HGDKSFHLTA  240
VIIDDSGYSD NTCYTTVLRL SEFAESLSLP FKYNFLRVHY AGDLDDFSRN CEGSVIISCD  300
TTNLCYTSLS KLQILLIGCV KKLQPKLVVI AEEDLVRMGK EASLSHASFV EFFFEGLHHF  360
TVLFESLASC FNGGDDKVCL RLVERDVVGP KIQDFVGQHG SETLKAAAGA NVLEGFMPCE  420
LSACNIAQAR LLVGLFSRSF GVANEKGRLQ LCWKSRPLVS VSVYTPVPKE KIL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-2411446418374GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002449036.10.0hypothetical protein SORBIDRAFT_05g003820
TrEMBLC5Y5600.0C5Y560_SORBI; Putative uncharacterized protein Sb05g003820
STRINGSb05g003820.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP76843250
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08250.12e-35GRAS family protein